CookSnap is coming soon — Join the waitlist →
Back to recipes

Pasta alla Carrettiera

A rustic Roman pasta with tomatoes, garlic, and a touch of heat—ready in under 30 minutes. Vegetarian, bold, and perfect for weeknight dinners.

Total time
28 min
Servings
2
Calories
520
Protein
18g
Pasta alla Carrettiera
comfortsimpleitalianvegetarianvegetariancreamytenderweeknight

Ingredients

  • 8 oz spaghetti or tonnarelli pasta
  • 14 oz canned whole tomatoes
  • 4 whole garlic cloves
  • 1 whole fresh red chili pepper (or 0.25 tsp red pepper flakes)
  • 3 tablespoon olive oil
  • 1 teaspoon salt
  • ¼ teaspoon pepper

Instructions

  1. 1

    Bring a large pot of water to a boil over high heat, about 8 minutes. Add 1 teaspoon of salt to the water.

  2. 2

    Slice each garlic clove thinly lengthwise (so you get flat, thin slices like playing cards, not rounds), then arrange them in a small pile next to your stove.

  3. 3

    If using a fresh red chili pepper, slice it in half lengthwise, remove the seeds with the tip of a knife, and cut it into 3–4 small pieces.

  4. 4

    Pour 3 tablespoons of olive oil into a large skillet and place it over medium heat for 60 seconds until the oil shimmers and slides quickly when you tilt the pan.

  5. 5

    Add the sliced garlic and chili pieces to the hot oil and stir constantly with a wooden spoon for 30 seconds until the garlic smells strongly fragrant (do not let it brown).

  6. 6

    Pour the entire can of tomatoes into the skillet, breaking apart the whole tomatoes with the wooden spoon into roughly 1-inch pieces as they fall into the oil.

  7. 7

    Reduce the heat to medium-low and let the sauce simmer, stirring once every 45 seconds, for 10 minutes until it thickens slightly and smells concentrated.

  8. 8

    While the sauce simmers, carefully place the spaghetti into the boiling water and stir once with a wooden spoon to separate the strands.

  9. 9

    Cook the pasta according to the package directions (usually 9–11 minutes) until it bends easily but still has a slight firmness when you bite a strand.

  10. 10

    Taste the sauce and add 0.25 teaspoon of pepper and more salt if needed—it should taste bold and slightly spicy.

  11. 11

    Drain the pasta in a colander, reserving 0.5 cup of the starchy cooking water in a small bowl.

  12. 12

    Pour the drained pasta directly into the skillet with the sauce and stir vigorously with a wooden spoon for 30 seconds until evenly coated.

  13. 13

    If the pasta looks dry, splash in a few tablespoons of the reserved cooking water and stir until the sauce clings to each strand in a light, glossy coat.

  14. 14

    Divide the pasta equally between two bowls or plates and serve immediately while steaming hot.

Tools you’ll need

  • large pot (5–6 quart)
  • large skillet (12-inch)
  • wooden spoon
  • colander
  • small bowl
  • tongs or pasta fork
  • cutting board
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.