CookSnap is coming soon — Join the waitlist →
Back to recipes

Spinach Ricotta Tortelloni

Jarred tortelloni with a silky brown butter and sage sauce — the kind of weeknight dinner that tastes like you spent an hour in the kitchen but took 15 minutes. Nutty, aromatic, complete.

Total time
15 min
Servings
2
Calories
520
Protein
22g
Spinach Ricotta Tortelloni
comfortelegantitalianvegetariancheesecreamytenderweeknight

Ingredients

  • 1 lb jarred spinach and ricotta tortelloni
  • 4 tbsp butter
  • 8 leaves fresh sage leaves
  • 2 cloves garlic cloves, thinly sliced
  • ½ lemon lemon (zested and juiced)
  • ½ cup Parmigiano-Reggiano, grated
  • ¼ tsp red pepper flakes

Instructions

  1. 1

    Bring a large pot of salted water to a boil. Add tortelloni and cook until they float, then 1 minute more, ~4 minutes total.

  2. 2

    While pasta cooks, melt butter in a large skillet over medium heat. Add sage and garlic, stirring constantly until fragrant, ~90 seconds.

  3. 3

    Keep stirring the butter—it will foam and turn golden-brown with toasted bits at the bottom, ~2 more minutes. Don't let it burn.

  4. 4

    Reserve 1 cup pasta water. Drain tortelloni and add to the butter sauce with lemon juice and red pepper flakes.

  5. 5

    Toss gently, adding pasta water 2 tablespoons at a time until the sauce coats each tortelloni and looks glossy.

  6. 6

    Divide between bowls. Top with lemon zest, Parmigiano-Reggiano, and a pinch of red pepper flakes. Serve immediately.

Tools you’ll need

  • large pot
  • large skillet
  • wooden spoon
  • microplane (for lemon zest)
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.