CookSnap is coming soon — Join the waitlist →

Tortelli di Zucca — Butter-Sage Pumpkin Pasta

Tender pasta pillows filled with roasted pumpkin, ricotta, and nutmeg, finished in brown butter and crispy sage. Restaurant-worthy in under 30 minutes using store-bought wonton wrappers.

Total time
28 min
Servings
2
Calories
520
Protein
18g
Tortelli di Zucca — Butter-Sage Pumpkin Pasta
elegantcomfortitalianvegetariancheesetendercreamyweeknight

Ingredients

  • 1 cup pumpkin or butternut squash, roasted
  • ½ cup ricotta cheese
  • ¼ cup Parmesan cheese, grated
  • 1 package (12 oz) wonton wrappers (about 30–36 wrappers)
  • 4 tbsp butter
  • 12 leaves fresh sage leaves
  • ¼ tsp nutmeg, freshly grated

Instructions

  1. 1

    Mix roasted pumpkin, ricotta, Parmesan, and nutmeg in a bowl until smooth. Season with salt and pepper.

  2. 2

    Spoon 1 tbsp filling onto the center of each wonton wrapper. Wet edges with water, fold into triangle, then bring corners together and press to seal.

  3. 3

    Bring a large pot of salted water to a boil. Add tortelli in batches and cook until they float, then 2 minutes more.

  4. 4

    While tortelli cook, melt butter in a large skillet over medium-high until foaming. Add sage and cook until leaves crisp, about 3 minutes.

  5. 5

    Scoop tortelli directly from the pot into the brown butter and sage. Toss gently to coat.

  6. 6

    Divide between bowls. Serve immediately with extra Parmesan and cracked black pepper.

Tools you’ll need

  • mixing bowl
  • large pot
  • large skillet
  • slotted spoon
  • microplane (for nutmeg)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.