CookSnap is coming soon — Join the waitlist →
Back to recipes

Sotteok Sotteok (Korean Fish Cake Skewers)

Chewy fish cake and vegetable skewers glazed in a sweet and spicy gochujang sauce. Ready in 20 minutes with minimal prep—perfect for a quick Korean snack or light meal.

Total time
20 min
Servings
2
Calories
285
Protein
18g
Sotteok Sotteok (Korean Fish Cake Skewers)
casualquickkoreanfishchewycrispyweeknightsnack

Ingredients

  • 12 oz fish cake (eomuk), sliced 1/2-inch thick
  • 8 skewers bamboo skewers (6-inch)
  • ½ medium onion onion, cut into 1-inch chunks
  • 3 tablespoons gochujang (Korean red chili paste)
  • 1.5 tablespoons sugar
  • 2 tablespoons vegetable oil

Instructions

  1. 1

    If using wooden skewers, soak them in cold water for 10 minutes so they don't burn when cooking.

  2. 2

    Thread each skewer by alternating: one fish cake slice, one onion chunk, repeat until you have 4 pieces per skewer.

  3. 3

    Heat the oil in a large skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 1 minute.

  4. 4

    Place the skewers in the pan in a single layer and cook for 2 minutes until the bottom surface turns light golden brown.

  5. 5

    Flip each skewer over and cook for another 2 minutes until the second side is also golden brown.

  6. 6

    In a small bowl, whisk together the gochujang and sugar with a fork until fully blended with no lumps.

  7. 7

    Pour the sauce over the skewers in the pan and toss to coat evenly, cooking for 1 minute until the sauce becomes glossy and sticky.

  8. 8

    Transfer the skewers to a serving plate, scraping any extra sauce from the pan onto them.

Tools you’ll need

  • 8 bamboo skewers (6-inch), soaked
  • cutting board
  • sharp knife
  • small bowl
  • fork
  • 12-inch nonstick skillet
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.