CookSnap is coming soon — Join the waitlist →
Back to recipes

Korean Twigim (Fried Mixed Bites)

Crispy fried strips of fish cake, potato, and mushroom tossed in a sweet-spicy gochujang glaze. Ready in 20 minutes—a TikTok-viral Korean street snack that tastes like a restaurant made it.

Total time
20 min
Servings
2
Calories
380
Protein
12g
Korean Twigim (Fried Mixed Bites)
casualindulgentkoreanfishcrispytenderweeknightcasual

Ingredients

  • 6 oz fish cake (eomuk), store-bought
  • 1 whole potato, medium
  • 4 oz shiitake mushrooms
  • 2 tbsp gochujang (Korean red chili paste)
  • 2 cups neutral cooking oil
  • 1 tbsp granulated sugar

Instructions

  1. 1

    Cut fish cake into 3-inch sticks, then cut potato lengthwise into 1/4-inch fries. Halve mushrooms.

  2. 2

    Mix gochujang with 2 tbsp water and 1 tbsp sugar until smooth; set aside.

  3. 3

    Heat oil in a medium pot over medium-high until a chopstick dipped in sizzles immediately, ~3 minutes.

  4. 4

    Working in two batches, fry fish cake, potato, and mushrooms until golden and crispy, ~4 minutes per batch.

  5. 5

    Transfer all fried pieces to a bowl. Pour off most oil, leaving ~1 tbsp in the pot.

  6. 6

    Add gochujang glaze to pot, warm 30 seconds, then toss fried bites to coat. Serve immediately.

Tools you’ll need

  • cutting board
  • chef's knife
  • medium pot or deep skillet
  • cooking thermometer or chopstick
  • slotted spoon or wire strainer
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.