CookSnap is coming soon — Join the waitlist →

Korean Tteok Kkochi (Rice Cake Skewers)

Chewy rice cakes and vegetables skewered together, then glazed with a sweet and savory gochujang sauce and crisped on a hot griddle. A beloved Korean street food snack that's quick, satisfying, and vegetarian.

Total time
25 min
Servings
2
Calories
240
Protein
4g
Korean Tteok Kkochi (Rice Cake Skewers)
casualsatisfyingkoreanvegetarianvegetarianchewycrispyweeknight

Ingredients

  • 8 oz Korean rice cakes (tteok), roughly 1-inch pieces
  • 1 medium bell pepper (any color), cut into 1-inch squares
  • ½ medium onion, cut into 1-inch squares
  • 2 tbsp gochujang (red chili paste)
  • 1 tbsp soy sauce
  • 1 tbsp honey or sugar

Instructions

  1. 1

    Soak the rice cakes in warm water for 5 minutes to soften them slightly, then drain them in a colander and pat them dry with a kitchen towel.

  2. 2

    Cut the bell pepper in half lengthwise from tip to stem, remove the seeds, then cut each half into 1-inch-wide pieces crosswise.

  3. 3

    Cut the onion in half lengthwise from root to tip, then cut each half into 1-inch-wide pieces by slicing crosswise.

  4. 4

    In a small bowl, whisk together the gochujang, soy sauce, and honey until completely smooth with no lumps, about 30 seconds.

  5. 5

    Thread the rice cakes, bell pepper pieces, and onion pieces alternately onto two 10-inch metal or bamboo skewers, fitting about 4 rice cakes and 4 vegetable pieces per skewer.

  6. 6

    Heat 1 tablespoon of oil in a 12-inch nonstick skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  7. 7

    Place both skewers in the hot skillet and cook without moving them for 2 minutes until the bottoms turn light golden brown.

  8. 8

    Rotate the skewers a quarter turn and cook for 2 minutes more, then repeat two more times (total 8 minutes) so all four sides of the rice cakes brown lightly.

  9. 9

    Brush the gochujang glaze thickly over all sides of both skewers using a silicone pastry brush or the back of a spoon.

  10. 10

    Continue cooking the glazed skewers, rotating every 30 seconds, for 2 minutes more until the glaze becomes glossy and sticky.

  11. 11

    Transfer the skewers to a serving plate and let them rest for 1 minute so the glaze sets slightly before eating.

Tools you’ll need

  • small mixing bowl
  • whisk
  • 12-inch nonstick skillet
  • two 10-inch metal or bamboo skewers
  • silicone pastry brush or spoon
  • kitchen towel
  • colander
  • chef's knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.