CookSnap is coming soon — Join the waitlist →

Crispy Rice Cake (Nurungji)

Nutty, crispy rice cakes made from leftover cooked rice, toasted until golden and topped with a savory-sweet soy glaze and sesame seeds. Ready in 20 minutes.

Total time
20 min
Servings
2
Calories
285
Protein
4g
Crispy Rice Cake (Nurungji)
simplesatisfyingkoreanvegetarianvegetariancrispychewysnack

Ingredients

  • 2 cups cooked white rice, cold
  • 2 tablespoons soy sauce
  • 1 tablespoon honey
  • ½ tablespoon rice vinegar
  • 1 tablespoon sesame seeds
  • 2 tablespoons olive oil
  • 0 to taste salt and pepper

Instructions

  1. 1

    In a small bowl, whisk together 2 tablespoons soy sauce, 1 tablespoon honey, and 0.5 tablespoon rice vinegar until the honey dissolves completely and the mixture is smooth.

  2. 2

    Spread the 2 cups of cold rice in a thin, even layer on a cutting board, pressing down gently with your hands to compact it into a flat slab about 0.5 inches thick.

  3. 3

    Cut the compacted rice into rectangles about 2 inches wide by 3 inches long (about the size of a playing card), using a knife or bench scraper to divide it into roughly 8–12 pieces.

  4. 4

    Heat 2 tablespoons olive oil in a 12-inch skillet over medium-high heat until the oil shimmers and slides quickly when you tilt the pan, about 90 seconds.

  5. 5

    Carefully place each rice rectangle into the hot oil, laying it flat on the surface — work in one batch if they fit without crowding, or in two batches if needed.

  6. 6

    Let the rice cakes sit without moving them for 2–3 minutes until the bottom surface turns golden brown and crispy, like the color of caramel or light toast.

  7. 7

    Using a spatula or tongs, flip each rice cake over and cook the other side for another 2–3 minutes until it also turns golden brown and feels crispy when you tap it.

  8. 8

    Remove the rice cakes from the skillet and transfer them to a plate lined with paper towels to drain excess oil for 30 seconds.

  9. 9

    Arrange the crispy rice cakes on a serving plate, standing them upright or laying them flat in a single layer.

  10. 10

    Drizzle the soy-honey glaze evenly over all the rice cakes until they are lightly coated on top and sides.

  11. 11

    Scatter 1 tablespoon of sesame seeds over the glazed rice cakes, covering as much surface as possible.

  12. 12

    Taste one rice cake, and sprinkle salt and pepper if desired — serve immediately while the cakes are still warm and crispy.

Tools you’ll need

  • small mixing bowl
  • whisk
  • cutting board
  • knife
  • 12-inch skillet
  • spatula or tongs
  • paper towels
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.