CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Chili Oil Rice Cakes

Pan-fried rice cakes glazed with aromatic chili oil, scallions, and sesame. Crispy outside, tender inside, ready in 15 minutes.

Total time
15 min
Servings
4
Calories
285
Protein
3g
Crispy Chili Oil Rice Cakes
casualquickchinesevegetariandairy-freecrispychewyweeknight

Ingredients

  • 12 oz rice cakes (cylindrical or square, ~12 oz)
  • 3 tbsp neutral cooking oil
  • 3 tbsp chili oil (store-bought)
  • 2 tbsp soy sauce
  • 3 cloves garlic, minced
  • 4 whole scallions, sliced into 1-inch pieces
  • 1 tbsp sesame seeds (white or black)

Instructions

  1. 1

    Heat neutral oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. 2

    Add rice cakes in a single layer and cook 2–3 minutes without stirring until golden on bottom.

  3. 3

    Flip rice cakes and cook another 2 minutes until the other side browns and edges crisp.

  4. 4

    Push rice cakes to the side, add minced garlic to the empty space, and cook 30 seconds until fragrant.

  5. 5

    Pour chili oil and soy sauce over rice cakes, toss gently for 1 minute until coated and glossy.

  6. 6

    Remove from heat, scatter scallions and sesame seeds on top, and serve immediately.

Tools you’ll need

  • large skillet (12-inch cast iron or non-stick)
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.