CookSnap is coming soon — Join the waitlist →

Solterito Arequipeño

A vibrant Peruvian corn and cheese salad from Arequipa, combining charred corn, creamy cheese, and a bright lime-cilantro dressing. Ready in 20 minutes with minimal prep.

Total time
20 min
Servings
4
Calories
285
Protein
9g
Solterito Arequipeño
freshlightperuvianvegetariancheesecrispycreamyweeknight

Ingredients

  • 3 cups corn kernels, fresh or frozen
  • 1 cup queso fresco or feta cheese, crumbled
  • ½ medium red onion
  • ¼ cup fresh cilantro, chopped
  • 3 tablespoons lime juice, freshly squeezed
  • 3 tablespoons olive oil

Instructions

  1. 1

    If using fresh corn, cut the kernels off the cob by holding the cob upright on a cutting board and scraping downward with a knife, rotating as you go, until all kernels fall into a bowl.

  2. 2

    Heat a large skillet over medium-high heat until it is very hot and a drop of water sizzles and evaporates immediately, about 2 minutes.

  3. 3

    Add the corn to the dry skillet with no oil and stir frequently until kernels turn golden brown and slightly charred in spots, about 5 minutes.

  4. 4

    Transfer the charred corn to a large bowl and let it cool for 2 minutes until it is comfortable to touch.

  5. 5

    Cut the red onion in half lengthwise from root to tip, then lay each half flat and slice crosswise into thin half-rings about 1/8 inch thick.

  6. 6

    Add the crumbled cheese, sliced red onion, and cilantro to the cooled corn and stir gently until everything is mixed together.

  7. 7

    Pour the lime juice and olive oil into the salad and toss gently until all ingredients are coated evenly.

  8. 8

    Taste a spoonful and add salt and pepper until it tastes bright and balanced — you should taste the lime, the charred corn, and the salty cheese equally.

Tools you’ll need

  • cutting board
  • chef's knife
  • 12-inch skillet
  • wooden spoon
  • large mixing bowl
  • kitchen towel (optional, for cooling)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.