CookSnap is coming soon — Join the waitlist →

Skillet Chocolate Chip Cookie

Warm, gooey cookie baked in a cast iron skillet and served straight from the pan with vanilla ice cream. Crispy edges, chewy center, ready in under 20 minutes.

Total time
18 min
Servings
4
Calories
520
Protein
6g
Skillet Chocolate Chip Cookie
indulgentcozyamericanvegetariancrispychewygooeydessert

Ingredients

  • ½ cup butter, softened
  • ¾ cup brown sugar
  • ¼ cup granulated sugar
  • 1 whole large egg
  • 1 tsp vanilla extract
  • 1.5 cups all-purpose flour
  • 1.5 cups chocolate chips
  • 1 pint vanilla ice cream, for serving

Instructions

  1. 1

    Preheat oven to 350°F. Mix softened butter, brown sugar, and granulated sugar in a bowl until creamy.

  2. 2

    Stir in egg and vanilla extract until fully combined.

  3. 3

    Fold in flour with a pinch of salt until no dry streaks remain, then fold in chocolate chips.

  4. 4

    Pour dough into a buttered 10-inch cast iron skillet, spreading evenly to the edges.

  5. 5

    Bake for 12-14 minutes until edges are golden brown but center still looks slightly underdone.

  6. 6

    Top with a scoop of vanilla ice cream and serve straight from the skillet while warm.

Tools you’ll need

  • 10-inch cast iron skillet
  • mixing bowl
  • spatula or wooden spoon
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.