CookSnap is coming soon — Join the waitlist →

Silky Chickpea Stew (Shiro)

Ethiopian chickpea flour stew with ginger, garlic, and chili heat. Creamy, savory, and ready in 25 minutes—serve with injera or flatbread.

Total time
25 min
Servings
4
Calories
220
Protein
10g
Silky Chickpea Stew (Shiro)
comfortwholesomeethiopianvegetarianveganchickpeascreamysmooth

Ingredients

  • 1 cup chickpea flour (besan)
  • 1 medium onion, finely diced
  • 4 cloves garlic, minced
  • 1 tbsp fresh ginger, minced
  • 1 tsp hot pepper (or cayenne powder)
  • 2 tbsp tomato paste
  • 2.5 cups water

Instructions

  1. 1

    Heat olive oil in a large pot over medium. Add diced onion and sauté until soft and translucent, about 4 minutes.

  2. 2

    Add minced garlic and ginger, stir constantly for 60 seconds until fragrant. Add tomato paste and stir to combine.

  3. 3

    Whisk chickpea flour with 1 cup water until smooth with no lumps. Pour the slurry slowly into the pot, stirring constantly.

  4. 4

    Add remaining 1.5 cups water and hot pepper. Bring to a gentle simmer, stirring frequently to prevent lumps.

  5. 5

    Simmer for 8–10 minutes, stirring often, until the stew thickens and darkens to a deep golden-brown. Taste and adjust salt and spice.

  6. 6

    Transfer to a serving platter. Make a shallow well in the center, drizzle with olive oil. Serve hot with injera or flatbread.

Tools you’ll need

  • large pot (3+ quart)
  • whisk
  • wooden spoon or silicone spatula
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.