CookSnap is coming soon — Join the waitlist →
Back to recipes

Chickpea Shiro Stew

A creamy, nutty Ethiopian chickpea flour stew served with injera or flatbread. Ready in under 10 minutes — no slow simmering required.

Total time
10 min
Servings
4
Calories
185
Protein
8g
Chickpea Shiro Stew
comfortheartyethiopianvegetarianveganchickpeascreamysmooth

Ingredients

  • ¾ cup chickpea flour (besan)
  • 3 cups water
  • 1 medium onion, finely diced
  • 3 cloves garlic, minced
  • 1 tbsp ginger, minced
  • 2 tsp berbere spice blend

Instructions

  1. 1

    Heat 2 tbsp olive oil in a large skillet over medium-high heat until shimmering, about 60 seconds.

  2. 2

    Add onion and cook, stirring often, until soft and translucent, about 3 minutes.

  3. 3

    Stir in garlic, ginger, and berbere; cook until fragrant, about 30 seconds.

  4. 4

    Whisk chickpea flour with 1 cup water until smooth, then pour into the skillet.

  5. 5

    Add remaining 2 cups water, stirring constantly to break up lumps. Bring to a simmer.

  6. 6

    Cook, stirring frequently, until the stew thickens and loses any raw flour taste, about 4 minutes. Season with salt and pepper.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.