CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Creamy Chickpea Genfo

Ethiopian comfort porridge made from roasted chickpea flour, butter, and spices—creamy, savory, and ready in minutes. Vegan when you skip the butter or use plant-based oil.

Total time
12 min
Servings
2
Calories
285
Protein
9g
Creamy Chickpea Genfo
comfortcozyethiopianveganvegetarianchickpeascreamysmooth

Ingredients

  • 1 cup chickpea flour (or ground roasted chickpeas)
  • 2 cups vegetable broth
  • 3 tbsp olive oil
  • ½ medium onion, minced
  • 2 cloves garlic, minced
  • 1 tsp berbere spice blend (or cayenne + paprika)

Instructions

  1. 1

    Heat oil in a large skillet over medium. Add onion and cook, stirring, until soft, ~3 minutes.

  2. 2

    Add garlic and berbere, stir until fragrant, ~30 seconds.

  3. 3

    Pour in broth slowly, stirring constantly to break up lumps, then add chickpea flour in a steady stream.

  4. 4

    Reduce heat to medium-low and simmer, stirring often, until thick and creamy, ~4 minutes.

  5. 5

    Taste and adjust salt and spice. Serve hot in bowls.

Tools you’ll need

  • large skillet (10-inch minimum)
  • wooden spoon
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.