Creamy Chickpea Genfo
Ethiopian comfort porridge made from roasted chickpea flour, butter, and spices—creamy, savory, and ready in minutes. Vegan when you skip the butter or use plant-based oil.
- Total time
- 12 min
- Servings
- 2
- Calories
- 285
- Protein
- 9g
comfortcozyethiopianveganvegetarianchickpeascreamysmooth
Ingredients
- 1 cup chickpea flour (or ground roasted chickpeas)
- 2 cups vegetable broth
- 3 tbsp olive oil
- ½ medium onion, minced
- 2 cloves garlic, minced
- 1 tsp berbere spice blend (or cayenne + paprika)
Instructions
- 1
Heat oil in a large skillet over medium. Add onion and cook, stirring, until soft, ~3 minutes.
- 2
Add garlic and berbere, stir until fragrant, ~30 seconds.
- 3
Pour in broth slowly, stirring constantly to break up lumps, then add chickpea flour in a steady stream.
- 4
Reduce heat to medium-low and simmer, stirring often, until thick and creamy, ~4 minutes.
- 5
Taste and adjust salt and spice. Serve hot in bowls.
Tools you’ll need
- large skillet (10-inch minimum)
- wooden spoon
- measuring cups and spoons
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
