Custrd is out on the App Store — Download it free →
Back to recipes

Creamy Chickpea Stew (Shiro Tegamino)

Ethiopian chickpea flour stew rich with garlic, ginger, and chili, finished with a silky paste and served with injera. Deeply savory, warming, and ready in under 20 minutes.

Total time
18 min
Servings
4
Calories
248
Protein
9g
Creamy Chickpea Stew (Shiro Tegamino)
comfortcozyethiopianvegetarianveganchickpeascreamysmooth

Ingredients

  • 1 cup chickpea flour (besan)
  • 2.5 cups water
  • 5 cloves garlic cloves, minced
  • 1 tbsp fresh ginger, grated
  • 1 whole scotch bonnet or jalapeño pepper, minced
  • 1 tbsp berbere spice blend (or paprika + cayenne)
  • 1 package injera (or flatbread) for serving

Instructions

  1. 1

    Heat 2 tbsp olive oil in a large pot over medium-high until it shimmers, ~90 seconds.

  2. 2

    Add minced garlic, ginger, and chili. Cook 60 seconds until fragrant, stirring constantly to avoid burning.

  3. 3

    Pour in water and bring to a boil. Whisk in chickpea flour slowly, breaking up lumps with the back of a spoon.

  4. 4

    Reduce heat to medium-low. Stir in berbere, salt, and pepper. Simmer 8–10 minutes, stirring frequently, until thickened and fragrant.

  5. 5

    The stew should be creamy and coat the back of a spoon. If too thick, thin with a splash of water. Taste and adjust seasoning.

  6. 6

    Serve hot over injera or with flatbread on the side. Drizzle with a little extra olive oil on top if desired.

Tools you’ll need

  • large pot (3–4 quart)
  • whisk
  • spoon
  • measuring cups
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.