CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Yemisir Kik with Eggs & Injera

Creamy yellow split pea stew spiked with ginger and turmeric, served with soft-boiled eggs, potatoes, and spongy injera. A weeknight version of the Ethiopian classic that's ready in 20 minutes.

Total time
20 min
Servings
2
Calories
280
Protein
16g
20-Min Yemisir Kik with Eggs & Injera
comfortwholesomeethiopianvegetarianveganchickpeascreamytender

Ingredients

  • 1 cup yellow split peas, dried
  • ½ cup yellow onion, diced
  • 1 tbsp fresh ginger, minced
  • 1 tsp turmeric powder
  • 2 whole eggs
  • 2 pieces injera or flatbread

Instructions

  1. 1

    Rinse split peas and add to a pot with 3 cups water, diced onion, minced ginger, and turmeric.

  2. 2

    Bring to a boil, then reduce heat and simmer 12–14 minutes until peas break down into a creamy paste.

  3. 3

    While the stew simmers, boil the eggs in a separate small pot for 6–7 minutes until soft-boiled.

  4. 4

    Season the stew with salt and pepper to taste, then stir until smooth and velvety.

  5. 5

    Warm injera in a dry skillet 30 seconds per side until pliable.

  6. 6

    Spoon stew onto injera, top with a soft-boiled egg, and serve with lime wedge.

Tools you’ll need

  • medium pot
  • small pot
  • wooden spoon
  • skillet

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.