Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Shrimp Mohinga

Silky chickpea-flour broth loaded with tender shrimp, finished with crispy fried shallots and a squeeze of lime. A streamlined Burmese noodle soup that tastes like you've been simmering it all day.

Total time
20 min
Servings
2
Calories
285
Protein
28g
20-Min Shrimp Mohinga
comfortcozyburmeseshrimpsilkytendercrispyweeknight

Ingredients

  • ¾ lb shrimp, peeled and deveined
  • ¼ cup chickpea flour (besan)
  • 2 tbsp fish sauce
  • 1 tbsp tamarind paste
  • 1 tbsp ginger, minced
  • ¼ cup fried shallots
  • 1 whole lime (halved for juicing)

Instructions

  1. 1

    Bring 4 cups water to a boil in a large pot over medium-high heat.

  2. 2

    Whisk chickpea flour with 0.5 cup cold water until smooth, then slowly pour into boiling water while stirring constantly to avoid lumps.

  3. 3

    Add ginger, fish sauce, and tamarind paste. Stir and simmer for 5 minutes until the broth turns silky and darkens slightly.

  4. 4

    Add shrimp and cook until they turn pink and curl, about 3 minutes. Taste and adjust seasoning with salt or fish sauce.

  5. 5

    Divide noodles or rice between bowls, pour broth and shrimp over top, and scatter fried shallots on each.

  6. 6

    Squeeze lime wedge over the bowl and serve immediately.

Tools you’ll need

  • large pot (4-quart minimum)
  • whisk
  • wooden spoon
  • bowls (2)
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.