Shrimp Mohinga Bowl
Burmese noodle soup with aromatic fish paste broth, crispy shallots, and tender shrimp. A one-pot weeknight version of the beloved breakfast classic.
- Total time
- 15 min
- Servings
- 2
- Calories
- 320
- Protein
- 28g
comfortcozyburmeseshrimptendersilkyweeknightcomfort-food-night
Ingredients
- 2 tbsp fish paste (nam pla or shrimp paste)
- ½ lb shrimp, peeled and deveined
- ¼ cup crispy fried shallots
- 6 oz fresh egg noodles or rice noodles
- 3 cloves garlic, minced
- 4 cups chicken or seafood broth
- 1 bunch fresh cilantro and lime wedges
Instructions
- 1
Heat oil in a pot over medium-high. Add garlic and cook 30 seconds until fragrant.
- 2
Stir in fish paste until dissolved, then pour in broth. Bring to a simmer.
- 3
Add noodles and shrimp. Simmer 4–5 minutes until shrimp turns opaque and noodles are tender.
- 4
Divide into bowls and top with crispy shallots and fresh cilantro. Serve with lime wedges.
Tools you’ll need
- large pot
- wooden spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
