Custrd is out on the App Store — Download it free →
Back to recipes

Sheet-Pan Ramazan Pidesi

Crispy, sesame-topped flatbread baked straight on a sheet pan—no dough-making required. Ready in 15 minutes with store-bought pizza dough and a brush of olive oil.

Total time
15 min
Servings
2
Calories
385
Protein
9g
Sheet-Pan Ramazan Pidesi
simplecomfortturkishvegetariancrispyflakyweeknightramadan

Ingredients

  • 1 pound store-bought pizza dough or naan
  • 3 tbsp olive oil
  • 3 tbsp sesame seeds
  • ½ tsp salt
  • 1 tbsp nigella seeds (or black sesame seeds)
  • 2 cloves garlic, minced

Instructions

  1. 1

    Heat oven to 425°F. Place pizza dough on a sheet pan and press into an even 1/4-inch-thick rectangle.

  2. 2

    Brush dough generously with olive oil. Sprinkle minced garlic, sesame seeds, nigella seeds, and salt across the surface.

  3. 3

    Bake until edges are deep golden and puffed, about 10–12 minutes. The top should look crispy and fragrant.

  4. 4

    Remove from oven and let cool 2 minutes. Cut into pieces and serve warm.

Tools you’ll need

  • sheet pan
  • oven
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.