Sheet-Pan Ramazan Pidesi
Crispy, sesame-topped flatbread baked straight on a sheet pan—no dough-making required. Ready in 15 minutes with store-bought pizza dough and a brush of olive oil.
- Total time
- 15 min
- Servings
- 2
- Calories
- 385
- Protein
- 9g

simplecomfortturkishvegetariancrispyflakyweeknightramadan
Ingredients
- 1 pound store-bought pizza dough or naan
- 3 tbsp olive oil
- 3 tbsp sesame seeds
- ½ tsp salt
- 1 tbsp nigella seeds (or black sesame seeds)
- 2 cloves garlic, minced
Instructions
- 1
Heat oven to 425°F. Place pizza dough on a sheet pan and press into an even 1/4-inch-thick rectangle.
- 2
Brush dough generously with olive oil. Sprinkle minced garlic, sesame seeds, nigella seeds, and salt across the surface.
- 3
Bake until edges are deep golden and puffed, about 10–12 minutes. The top should look crispy and fragrant.
- 4
Remove from oven and let cool 2 minutes. Cut into pieces and serve warm.
Tools you’ll need
- sheet pan
- oven
- pastry brush
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.


