CookSnap is coming soon — Join the waitlist →

Sheet Pan Quesadillas

Crispy, cheesy quesadillas baked on a sheet pan with seasoned beans, peppers, and cheese. Ready in under 20 minutes with minimal cleanup.

Total time
18 min
Servings
2
Calories
520
Protein
18g
Sheet Pan Quesadillas
comfortquickmexicanvegetariancheesecrispymeltyweeknight

Ingredients

  • 4 count flour tortillas (8-inch)
  • 1 can (15 oz) canned black beans, drained and rinsed
  • 1 medium bell pepper (any color), diced
  • 2 cups shredded cheddar cheese
  • ½ tsp cumin
  • 2 tbsp olive oil

Instructions

  1. 1

    Preheat oven to 425°F. Line a large sheet pan with parchment paper.

  2. 2

    Stir beans, diced pepper, and cumin in a bowl until combined.

  3. 3

    Place 2 tortillas on the prepared sheet pan, spacing them 2 inches apart.

  4. 4

    Divide bean mixture evenly between the 2 tortillas, leaving a 0.5-inch border.

  5. 5

    Sprinkle 0.5 cup cheese over each, then top with remaining tortillas.

  6. 6

    Brush the top of each quesadilla with 0.5 tbsp olive oil.

  7. 7

    Bake until edges are golden and cheese melts, 6–8 minutes.

  8. 8

    Cut each quesadilla in half and serve hot.

Tools you’ll need

  • sheet pan (13x18 inch or larger)
  • parchment paper
  • small mixing bowl
  • spoon
  • pastry brush
  • chef's knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.