CookSnap is coming soon — Join the waitlist →
Back to recipes

Black Bean Quesadilla

Crispy, cheesy quesadillas stuffed with seasoned black beans and melted cheese. Ready in 20 minutes with pantry staples and a skillet.

Total time
20 min
Servings
2
Calories
480
Protein
16g
Black Bean Quesadilla
comfortquickmexicanvegetariancheesecrispymeltyweeknight

Ingredients

  • 1 can (15 oz) black beans, canned
  • 1.5 cups cheddar cheese, shredded
  • 4 pieces flour tortillas (8-inch)
  • ½ cup diced tomato or salsa
  • ½ tsp cumin
  • 1 tbsp olive oil
  • 1 to taste salt and pepper

Instructions

  1. 1

    Drain and rinse black beans. Stir in cumin, diced tomato, and a pinch of salt.

  2. 2

    Heat oil in a 10-inch skillet over medium heat until shimmering, ~60 seconds.

  3. 3

    Place one tortilla in the skillet. Spread 2 tbsp black bean mixture on half.

  4. 4

    Sprinkle 3 tbsp cheese over the beans. Fold tortilla in half.

  5. 5

    Cook 2 minutes without moving until the bottom is golden and crispy.

  6. 6

    Flip and cook the other side 1.5 minutes until the tortilla is golden.

  7. 7

    Transfer to a plate. Repeat with remaining tortillas, beans, and cheese.

  8. 8

    Let cool 1 minute. Cut each quesadilla in half. Serve hot.

Tools you’ll need

  • 10-inch skillet
  • cutting board
  • kitchen knife
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.