CookSnap is coming soon — Join the waitlist →

Quesadillas de Huitlacoche

Crispy pan-fried quesadillas filled with earthy huitlacoche (corn fungus), melted cheese, and onions. A traditional Mexican delicacy ready in 15 minutes.

Total time
15 min
Servings
2
Calories
385
Protein
14g
Quesadillas de Huitlacoche
casualcomfortmexicanvegetariancheesecrispymeltyweeknight

Ingredients

  • 4 count corn tortillas (6-inch or 8-inch)
  • 1.5 cups huitlacoche (canned or fresh)
  • ½ count white onion
  • 1 cup Oaxaca or mozzarella cheese, shredded
  • 2 tbsp olive oil
  • 0 to taste salt and pepper

Instructions

  1. 1

    Dice onion into small pieces. Drain huitlacoche if canned and pat dry with paper towels.

  2. 2

    Warm tortillas in a dry skillet over medium heat, 20 seconds per side until pliable.

  3. 3

    Warm 1 tbsp oil in skillet over medium. Add onion, cook until soft, about 2 minutes.

  4. 4

    Add huitlacoche to onion, stir, and cook until warmed through, about 1 minute. Season with salt and pepper.

  5. 5

    Spread 2 tbsp cheese on one tortilla. Top with 2 tbsp huitlacoche mixture, then 2 tbsp cheese and another tortilla.

  6. 6

    Wipe skillet clean. Heat remaining oil over medium-high until it shimmers, about 30 seconds.

  7. 7

    Pan-fry quesadilla 2 minutes per side until golden brown and cheese melts.

  8. 8

    Transfer to cutting board, slice into wedges, and serve immediately.

Tools you’ll need

  • 10-inch skillet or griddle
  • cutting board
  • knife
  • wooden spoon or spatula
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.