CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Swiss Malakoff Stack

Crispy layers of bread and melted cheese stacked high—a Swiss bistro classic that's ready in 15 minutes. Buttery, indulgent, and utterly simple.

Total time
15 min
Servings
2
Calories
520
Protein
22g
Swiss Malakoff Stack
comfortsimpleswissvegetariancheesecrispymeltygooey

Ingredients

  • 4 slices white bread, sliced thick (1-inch slices)
  • 200 g gruyère cheese, sliced thin
  • 3 tbsp butter
  • 2 tsp dijon mustard
  • 50 g ham or prosciutto, sliced thin
  • 2 sprigs fresh thyme sprigs

Instructions

  1. 1

    Spread one side of each bread slice with a thin layer of Dijon mustard.

  2. 2

    Layer 2 slices of gruyère, a pinch of ham, and thyme on 2 bread slices. Top each with a second bread slice, mustard-side down.

  3. 3

    Heat 1.5 tbsp butter in a large skillet over medium-high until foaming, about 90 seconds.

  4. 4

    Lay one sandwich in the pan and cook 2–3 minutes until golden brown and starting to crisp.

  5. 5

    Flip, add remaining 1.5 tbsp butter to the pan, and cook the second side 2–3 minutes until golden and cheese melts.

  6. 6

    Transfer to a plate. Repeat with the second sandwich. Serve immediately while cheese is still oozing.

Tools you’ll need

  • large skillet (12-inch)
  • spatula
  • knife for spreading

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.