CookSnap is coming soon — Join the waitlist →
Back to recipes

Sheet Pan Quesadilla

Crispy-edged cheese and vegetable quesadillas baked on a sheet pan with minimal hands-on time. Serve with sour cream, salsa, and hot sauce for a weeknight dinner that feels indulgent.

Total time
25 min
Servings
4
Calories
420
Protein
14g
Sheet Pan Quesadilla
casualcomfortmexicanvegetariancrispymeltyweeknightquesadilla

Ingredients

  • 8 count flour tortillas (8-inch)
  • 2 cups shredded Oaxaca or mozzarella cheese
  • 1 large bell pepper (any color), diced
  • ½ medium white onion, diced
  • 3 tbsp olive oil
  • ½ tsp salt
  • ¼ tsp black pepper
  • 1 set sour cream, salsa, or hot sauce for serving

Instructions

  1. 1

    Preheat oven to 425°F. Line a large sheet pan with parchment paper.

  2. 2

    Toss diced pepper and onion with 1 tbsp olive oil, salt, and black pepper.

  3. 3

    Arrange 4 tortillas on the sheet pan. Divide vegetables evenly among them.

  4. 4

    Top each with 1/4 cup cheese, then cover with remaining 4 tortillas.

  5. 5

    Brush both sides of each quesadilla lightly with remaining 2 tbsp olive oil.

  6. 6

    Bake until golden brown and crispy, about 12–15 minutes, until cheese melts.

  7. 7

    Cool 2 minutes. Cut each quesadilla in half. Serve with sour cream and salsa.

Tools you’ll need

  • sheet pan
  • parchment paper
  • large bowl
  • brush or spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.