CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sheet-Pan Focaccia Barese

Pillowy, olive-oil-soaked focaccia with crispy edges and dimpled tops, finished with tomatoes and herbs. Baked on one sheet pan in under 20 minutes using store-bought dough.

Total time
18 min
Servings
4
Calories
312
Protein
6g
Sheet-Pan Focaccia Barese
comfortsimpleitalianvegetariancrispyfluffysoftBread

Ingredients

  • 1 lb store-bought pizza dough (room temperature)
  • ¼ cup extra-virgin olive oil, divided
  • 1 cup cherry tomatoes
  • 3 sprigs fresh rosemary sprigs
  • 1.5 tsp coarse sea salt
  • 3 cloves garlic, thinly sliced

Instructions

  1. 1

    Heat oven to 425°F. Stretch dough into a 9×13-inch rectangle on a sheet pan coated with 1 tbsp olive oil.

  2. 2

    Use your fingertips to create deep dimples all over the surface, pushing down until your finger hits the pan.

  3. 3

    Drizzle remaining oil over dough. Scatter tomatoes, garlic, and rosemary into and around the dimples.

  4. 4

    Sprinkle coarse salt over top. Bake until edges are deep golden and surface is set, 12–14 minutes.

  5. 5

    Cool 2 minutes in the pan, then slide onto a cutting board and slice into squares or rectangles.

Tools you’ll need

  • 13×9-inch sheet pan
  • oven
  • fingertips
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.