10-Min Sesame Veggie Fried Rice
Crispy veggie fried rice with a soy-sesame glaze, ready in 10 minutes flat. Loads of color, zero fuss — the weeknight dinner that tastes better than takeout.
- Total time
- 10 min
- Servings
- 2
- Calories
- 285
- Protein
- 6g
quicksatisfyingasianvegetarianvegancrispytenderweeknight
Ingredients
- 2 cups cooked rice (white or brown, cooled or day-old)
- 1.5 cups frozen mixed vegetables
- 2 tbsp soy sauce
- 2 tbsp sesame seeds
Instructions
- 1
Heat 2 tbsp oil in a large skillet over medium-high until shimmering, about 60 seconds.
- 2
Add frozen vegetables and stir constantly until heated through and edges char slightly, 3 minutes.
- 3
Add rice, breaking up clumps, then drizzle soy sauce and toss until every grain is coated, 2 minutes.
- 4
Remove from heat and sprinkle sesame seeds over the top.
- 5
Serve immediately in bowls.
Tools you’ll need
- large skillet (12-inch)
- wooden spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
