CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Senfeier (Mustard Eggs)

Creamy German comfort food: hard-boiled eggs in a rich mustard-butter sauce, traditionally served with boiled potatoes. A classic Swabian dish that's simple, satisfying, and ready in 30 minutes.

Total time
25 min
Servings
4
Calories
285
Protein
14g
Senfeier (Mustard Eggs)
comfortcozygermanvegetarianeggscreamytenderweeknight

Ingredients

  • 8 large eggs
  • 3 tbsp butter
  • 2 tbsp all-purpose flour
  • 3 tbsp whole-grain mustard
  • 1 cup chicken or vegetable broth
  • 1 pinch to taste salt and black pepper

Instructions

  1. 1

    Place eggs in a pot, cover with cold water, and bring to a boil.

  2. 2

    Once boiling, remove from heat, cover, and let sit 10 minutes.

  3. 3

    Transfer eggs to ice water, cool for 2 minutes, then peel and halve.

  4. 4

    Melt butter in a large saucepan over medium heat, ~1 minute.

  5. 5

    Whisk in flour to form a roux, cooking until light golden, ~2 minutes.

  6. 6

    Gradually whisk in broth, stirring constantly until smooth and thickened.

  7. 7

    Stir in mustard until fully combined; sauce should smell tangy and fragrant.

  8. 8

    Gently add egg halves and simmer 2 minutes to warm through.

  9. 9

    Season with salt and pepper to taste.

  10. 10

    Transfer to a serving dish and pour sauce over eggs. Serve hot.

Tools you’ll need

  • large pot
  • ice bath (bowl + ice water)
  • large saucepan
  • whisk
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.