Custrd is out on the App Store — Download it free →
Back to recipes

Papa a la Huancaína — 25-Minute Shortcut

Boiled potatoes cloaked in a vibrant yellow ají amarillo sauce made with cashews and evaporated milk. Topped with hard-boiled eggs and olives — the Peruvian comfort classic, streamlined for a weeknight.

Total time
25 min
Servings
4
Calories
485
Protein
16g
Papa a la Huancaína — 25-Minute Shortcut
comfortwholesomeperuvianvegetarianeggscreamytenderweeknight

Ingredients

  • 3 tbsp ají amarillo paste
  • ¾ cup roasted cashews, unsalted
  • 1 cup evaporated milk
  • ½ cup queso fresco or feta, crumbled
  • 2 lb yellow potatoes, medium
  • 4 whole eggs
  • ½ cup green olives, pitted
  • 3 tbsp fresh cilantro, chopped

Instructions

  1. 1

    Boil potatoes in salted water until fork-tender, about 15 minutes. In the last 4 minutes, add eggs.

  2. 2

    While they cook, blend ají amarillo paste, cashews, evaporated milk, and 1/2 tsp salt until smooth and pourable.

  3. 3

    Drain potatoes and eggs. Peel eggs under cool water, then halve them.

  4. 4

    Arrange warm potatoes on a platter. Pour sauce over the top until potatoes are mostly covered.

  5. 5

    Scatter egg halves, olives, crumbled queso, and cilantro over the sauce.

  6. 6

    Serve warm. Sauce should be glossy and cling to each potato.

Tools you’ll need

  • large pot with lid
  • blender or food processor
  • colander
  • cutting board
  • serving platter

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.