CookSnap is coming soon — Join the waitlist →
Back to recipes

Shakshuka — Tomato Egg Skillet with Crusty Bread

Eggs poached in a spiced tomato sauce — a Mediterranean breakfast that feels like dinner. Serve with crusty bread for soaking up the sauce.

Total time
18 min
Servings
2
Calories
285
Protein
14g
Shakshuka — Tomato Egg Skillet with Crusty Bread
comfortrusticmediterraneanvegetarianeggscreamytenderweeknight

Ingredients

  • 1 can (14 oz) canned crushed tomatoes
  • ½ medium onion, diced
  • 4 large eggs
  • ½ tsp cumin
  • 1 loaf or 4 thick slices crusty bread
  • 3 tbsp fresh cilantro or parsley, chopped

Instructions

  1. 1

    Heat olive oil in a 10-inch skillet over medium. Add diced onion, cook until soft and translucent, ~4 minutes.

  2. 2

    Stir in cumin, then pour in crushed tomatoes. Simmer uncovered for 5 minutes until sauce thickens slightly.

  3. 3

    Make 4 small wells in the sauce. Crack an egg into each well, spacing them evenly around the pan.

  4. 4

    Cover and simmer over medium-low until egg whites set but yolks still jiggle when gently shaken, ~6 minutes.

  5. 5

    Scatter cilantro or parsley over the top. Season with salt and pepper to taste.

  6. 6

    Serve hot in the skillet with warm crusty bread for soaking.

Tools you’ll need

  • 10-inch skillet with lid
  • wooden spoon
  • cutting board and knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.