CookSnap is coming soon — Join the waitlist →
Back to recipes

Shakshuka — Baked Eggs in Tomato Sauce

Spiced tomato sauce bubbling in a skillet with eggs nestled on top and baked until whites set but yolks stay runny. Tear crusty bread and dip into the rich, tangy sauce — total comfort on a plate.

Total time
20 min
Servings
2
Calories
285
Protein
14g
Shakshuka — Baked Eggs in Tomato Sauce
comfortrusticmediterraneanvegetarianeggscreamytenderweeknight

Ingredients

  • 2 tbsp olive oil
  • 1 medium, diced yellow onion
  • 3 cloves, minced garlic
  • 1 14 oz can canned crushed tomatoes
  • 4 large eggs
  • 1 small loaf, sliced crusty bread

Instructions

  1. 1

    Heat olive oil in a 10-inch skillet over medium heat. Add diced onion and sauté until softened and translucent, about 4 minutes.

  2. 2

    Add minced garlic and cook for 30 seconds until fragrant, then pour in crushed tomatoes with a pinch each of salt and pepper.

  3. 3

    Simmer the sauce for 5 minutes, stirring occasionally, until it darkens slightly and flavors meld.

  4. 4

    Create four small wells in the sauce with the back of a spoon. Crack an egg into each well.

  5. 5

    Cover the skillet and cook over medium-low heat for 4–5 minutes until egg whites are set but yolks still jiggle when you shake the pan.

  6. 6

    Serve the skillet hot with sliced bread alongside for dipping into the sauce and breaking the runny yolks.

Tools you’ll need

  • 10-inch skillet with lid
  • cutting board
  • knife
  • wooden spoon
  • small bowl or cup for cracking eggs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Mediterranean recipes →