CookSnap is coming soon — Join the waitlist →
Back to recipes

Sara Udon Crispy Noodles

Japanese crispy fried noodles topped with sautéed shrimp, vegetables, and a silky egg ribbons in a light soy-butter sauce. Crunchy, savory, and ready in under 25 minutes.

Total time
22 min
Servings
2
Calories
480
Protein
28g
Sara Udon Crispy Noodles
satisfyingquickjapaneseshrimpcrispytenderweeknightpasta

Ingredients

  • 10 oz fresh udon noodles
  • 10 oz shrimp, peeled and deveined
  • 3 tbsp vegetable oil for frying
  • 1 whole medium carrot, julienned
  • 2 whole eggs, beaten
  • 2 tbsp soy sauce
  • 1 tbsp butter

Instructions

  1. 1

    Pat shrimp dry with paper towels and season with salt and pepper.

  2. 2

    Separate udon strands gently with your fingers so they don't clump.

  3. 3

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering, about 90 seconds.

  4. 4

    Add udon noodles in a flat layer and fry without stirring 3-4 minutes until golden and crispy on bottom.

  5. 5

    Flip noodle cake and fry the other side 2-3 minutes until crispy all over. Slide onto a plate.

  6. 6

    Add remaining 1 tbsp oil to the skillet and sear shrimp 90 seconds per side without moving.

  7. 7

    Push shrimp to the side, pour beaten eggs into empty space, and scramble until just set, about 60 seconds.

  8. 8

    Toss in carrot and stir until warmed through, roughly 90 seconds.

  9. 9

    Add soy sauce and butter, stirring until the butter melts and coats everything, about 30 seconds.

  10. 10

    Slide crispy noodle cake onto a serving plate and top with shrimp-egg mixture.

Tools you’ll need

  • large 12-inch nonstick or cast iron skillet
  • paper towels
  • spatula or fish turner
  • spoon for stirring

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.