CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sara Udon with Crispy Shrimp

Quick-fried ramen noodles topped with crispy shrimp, scallions, and a silky egg ribbons in a savory udon broth. Restaurant-quality in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
28g
Sara Udon with Crispy Shrimp
satisfyingquickjapaneseshrimpcrispytenderweeknightpasta

Ingredients

  • 6 oz ramen noodles (wavy chuka soba or crispy fried ramen)
  • 8 oz large shrimp, peeled and deveined
  • 1.5 cups dashi or chicken broth
  • 2 tbsp soy sauce
  • 1 tbsp mirin
  • 2 whole eggs
  • 2 whole scallions, chopped

Instructions

  1. 1

    Boil salted water in a pot. Cook ramen until just al dente, ~3 minutes. Drain and set aside.

  2. 2

    Pat shrimp dry with paper towels. Season with salt and pepper.

  3. 3

    In a small bowl, whisk together dashi, soy sauce, and mirin. Set aside.

  4. 4

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering, ~60 seconds.

  5. 5

    Add shrimp in a single layer. Sear without stirring for 90 seconds until edges curl and turn pink.

  6. 6

    Flip shrimp and cook 60 seconds more until opaque. Transfer to a plate.

  7. 7

    In the same skillet, add cooked ramen. Spread in a single layer and cook undisturbed for 90 seconds.

  8. 8

    Toss ramen to crisp all sides, cooking 60 seconds more until golden and crunchy edges form.

  9. 9

    Pour broth mixture over ramen. Stir to coat evenly and bring to a gentle simmer, ~60 seconds.

  10. 10

    Push ramen to the edges of the skillet. Pour beaten eggs into the center and scramble until set, ~90 seconds.

  11. 11

    Divide noodles between two bowls. Top with crispy shrimp, egg ribbons, and scallions.

  12. 12

    Drizzle any remaining broth over the top and serve immediately.

Tools you’ll need

  • pot
  • large skillet (12-inch)
  • small bowl
  • whisk
  • paper towels
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.