CookSnap is coming soon — Join the waitlist →
Back to recipes

Sara Udon Crispy Noodles with Seafood

Crispy fried udon noodles topped with a savory seafood sauce and fresh garnishes. A Japanese restaurant favorite that's surprisingly achievable at home in under 30 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
28g
Sara Udon Crispy Noodles with Seafood
satisfyingelegantjapaneseshrimpcrispytenderweeknightdate-night

Ingredients

  • 12 oz cooked udon noodles, chilled
  • 3 tbsp vegetable oil (for frying)
  • 8 oz shrimp, peeled and deveined
  • 3 tbsp oyster sauce
  • 1 tbsp soy sauce
  • 1 tbsp mirin (sweet rice wine)
  • 2 cloves garlic, minced
  • 2 stalks scallions, sliced thin (white and green separated)
  • ¼ cup bonito flakes (katsuobushi)
  • 1 tsp sesame seeds

Instructions

  1. 1

    Pat udon noodles dry with paper towels; separate any clumps with your fingers.

  2. 2

    Mix oyster sauce, soy sauce, and mirin in a small bowl.

  3. 3

    Heat oil in a 12-inch skillet over medium-high until shimmering, ~90 seconds.

  4. 4

    Add udon noodles in a single layer. Press down with a spatula; don't stir.

  5. 5

    Cook until the bottom is golden and crispy, ~3 minutes. Flip and crisp the other side.

  6. 6

    Push noodles to the side. Add shrimp to the empty space and sear 90 seconds per side.

  7. 7

    Add garlic to the shrimp, stir constantly for 30 seconds until fragrant.

  8. 8

    Pour sauce over noodles and shrimp. Toss to coat; cook 30 seconds more.

  9. 9

    Divide between plates. Top with white scallion parts, bonito flakes, and sesame seeds.

  10. 10

    Garnish with green scallion tops. Serve immediately.

Tools you’ll need

  • 12-inch nonstick or cast-iron skillet
  • small mixing bowl
  • spatula
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.