CookSnap is coming soon — Join the waitlist →
Back to recipes

Bay Area Garlic Noodles with Shrimp

Buttery, garlicky chow mein noodles loaded with sautéed shrimp and soy umami. A San Francisco dim sum classic ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
545
Protein
32g
Bay Area Garlic Noodles with Shrimp
quicksatisfyingcalifornianshrimpcrispytenderweeknightpasta

Ingredients

  • 8 oz chow mein noodles or thin egg noodles
  • ¾ lb large shrimp, peeled and deveined
  • 6 cloves garlic cloves, minced
  • 4 tbsp butter
  • 3 tbsp soy sauce
  • 1 tbsp oyster sauce
  • ½ tbsp sesame oil
  • 3 stalks scallions, sliced thin, plus extra for serving

Instructions

  1. 1

    Boil salted water in a large pot. Add noodles and cook until al dente, ~4 minutes. Drain and set aside.

  2. 2

    Pat shrimp dry with paper towels. Season lightly with salt and pepper.

  3. 3

    Heat 2 tbsp butter in a large skillet over medium-high until foaming. Add shrimp and sear 90 seconds per side without stirring until edges curl and surface is opaque.

  4. 4

    Transfer shrimp to a plate. Add remaining 2 tbsp butter and minced garlic to the skillet. Stir constantly for 60 seconds until fragrant and golden at the edges.

  5. 5

    Pour in soy sauce and oyster sauce. Stir to combine, then add the cooked noodles. Toss constantly for 2 minutes until noodles are glossy and heated through.

  6. 6

    Return shrimp to the skillet. Drizzle sesame oil and add sliced scallions. Toss gently to combine.

  7. 7

    Divide between bowls. Top with extra scallions and serve immediately.

Tools you’ll need

  • large pot
  • colander
  • paper towels
  • 12-inch skillet
  • wooden spoon
  • kitchen tongs
  • plates or bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.