CookSnap is coming soon — Join the waitlist →
Back to recipes

Samosa Chaat

Crispy fried samosas layered with tangy yogurt, spiced chickpeas, and bright tamarind chutney. A show-stopping vegetarian street-food snack that looks restaurant-quality but comes together in under an hour.

Total time
50 min
Servings
2
Calories
520
Protein
12g
Samosa Chaat
indulgentcasualindianvegetarianchickpeascrispycreamycrunchy

Ingredients

  • 8 pieces frozen samosas (potato and pea filling)
  • 2 cups neutral oil for frying
  • ½ cup plain yogurt
  • 1 can (15 oz) canned chickpeas, drained and rinsed
  • ¼ cup tamarind chutney
  • ½ teaspoon cumin seeds
  • ½ teaspoon chat masala or garam masala
  • ¼ cup fresh cilantro and mint, chopped, combined
  • 1 pinch salt and black pepper to taste

Instructions

  1. 1

    Pour the 2 cups of neutral oil into a large, deep skillet or small pot. Heat over medium-high heat until the oil shimmers and a small piece of samosa dropped in sizzles immediately, about 4 minutes.

  2. 2

    Carefully place 4 frozen samosas into the hot oil, keeping them separate so they do not touch. Fry without moving them for 2 minutes until the bottom turns golden honey-brown.

  3. 3

    Use a slotted spoon to flip each samosa, then fry the other side for 1.5 minutes until it matches the golden-brown color of the first side.

  4. 4

    Transfer the cooked samosas to a plate lined with paper towels. Repeat steps 2–3 with the remaining 4 samosas, then let all of them drain for 2 minutes.

  5. 5

    While samosas are draining, pour the 0.5 cup cumin seeds into a small dry skillet over medium heat and stir constantly until they darken and smell intensely fragrant, about 1 minute.

  6. 6

    Remove the skillet from heat and immediately stir in the 0.5 teaspoon of chat masala. Tip the mixture into a small bowl and let it cool for 1 minute.

  7. 7

    In a separate small bowl, stir the 1 can of drained chickpeas with the cooled spice mixture and a pinch of salt and pepper until evenly coated.

  8. 8

    Arrange the 8 fried samosas on a serving plate, breaking 4 of them in half to expose their insides and create a mix of whole and broken pieces.

  9. 9

    Drizzle the 0.5 cup of plain yogurt evenly across all the samosa pieces, letting it pool slightly in the crevices.

  10. 10

    Scatter the spiced chickpea mixture over the yogurt, covering as much surface area as you can.

  11. 11

    Drizzle the 0.25 cup of tamarind chutney across the plate in a zigzag pattern, then scatter the 0.25 cup of chopped cilantro and mint on top.

  12. 12

    Serve immediately while the samosas are still warm and crispy.

Tools you’ll need

  • large deep skillet or small pot
  • instant-read or meat thermometer (optional, for oil temperature verification)
  • slotted spoon
  • paper towels
  • small dry skillet
  • 2 small bowls
  • serving plate
  • cutting board and knife for herbs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.