Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Puchka with Tangy Spiced Water

Hollow, crispy fried shells filled with spiced potato, chickpeas, and fresh herbs, served with tangy tamarind-mint water. This street-food favorite comes together in 25 minutes with store-bought shells as the shortcut.

Total time
25 min
Servings
2
Calories
165
Protein
5g
Crispy Puchka with Tangy Spiced Water
casualfreshindianvegetarianchickpeascrispycrunchyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Make the tangy water: whisk tamarind paste, mint, chili powder, salt, and 1 cup water until the paste dissolves completely and the water turns golden-brown.

  2. Step 2

    Toss diced potato and chickpeas together in a small bowl with a pinch of salt and black pepper.

  3. Step 3

    Hold each puchka shell gently and make a small hole in the top with your thumb, being careful not to crack it.

  4. Step 4

    Spoon 1 tbsp of the potato-chickpea mixture into each shell, packing it in lightly.

  5. Step 5

    Arrange filled shells on a plate and pour the tangy water into a small cup alongside for dipping.

  6. Step 6

    Dip each puchka into the tangy water, pop it in your mouth, and let the shell shatter on your tongue.

Tools you’ll need

  • small mixing bowl
  • small cup or dipping bowl
  • spoon
  • whisk
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.