CookSnap is coming soon — Join the waitlist →

Crispy Puchka with Tangy Spiced Water

Hollow, crispy fried shells filled with spiced potato, chickpeas, and fresh herbs, served with tangy tamarind-mint water. This street-food favorite comes together in 25 minutes with store-bought shells as the shortcut.

Total time
25 min
Servings
2
Calories
165
Protein
5g
Crispy Puchka with Tangy Spiced Water
casualfreshindianvegetarianchickpeascrispycrunchyweeknight

Ingredients

  • 12 count puchka shells (store-bought, or make your own fried dough balls)
  • 1 medium boiled potato, diced small
  • ½ cup cooked chickpeas
  • 2 tbsp tamarind paste
  • 2 tbsp fresh mint leaves, chopped
  • ½ tsp red chili powder
  • 1 cup water (for the tangy water)

Instructions

  1. 1

    Make the tangy water: whisk tamarind paste, mint, chili powder, salt, and 1 cup water until the paste dissolves completely and the water turns golden-brown.

  2. 2

    Toss diced potato and chickpeas together in a small bowl with a pinch of salt and black pepper.

  3. 3

    Hold each puchka shell gently and make a small hole in the top with your thumb, being careful not to crack it.

  4. 4

    Spoon 1 tbsp of the potato-chickpea mixture into each shell, packing it in lightly.

  5. 5

    Arrange filled shells on a plate and pour the tangy water into a small cup alongside for dipping.

  6. 6

    Dip each puchka into the tangy water, pop it in your mouth, and let the shell shatter on your tongue.

Tools you’ll need

  • small mixing bowl
  • small cup or dipping bowl
  • spoon
  • whisk
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.