CookSnap is coming soon — Join the waitlist →

Basket Chaat

Crispy fried potato baskets filled with spiced chickpeas, yogurt, and chutneys—a street-food favorite that's surprisingly doable at home. Tangy, spicy, and completely vegetarian.

Total time
35 min
Servings
2
Calories
420
Protein
11g
Basket Chaat
casualindulgentindianvegetarianchickpeascrispycreamycrunchy

Ingredients

  • 2 whole potatoes, medium
  • 1 can (15 oz) chickpeas, canned (drained)
  • ½ cup yogurt, plain
  • 1 tbsp tamarind paste (or lime juice)
  • ½ tsp red chili powder
  • ½ tsp cumin seeds
  • 3 cups vegetable oil, for frying

Instructions

  1. 1

    Cut potatoes in half lengthwise. Using a small knife, carefully hollow out each half, leaving a thin shell for the basket.

  2. 2

    Pat potato baskets dry with paper towels — moisture is the enemy when frying.

  3. 3

    Toss drained chickpeas with red chili powder, cumin seeds, tamarind paste, and salt to taste.

  4. 4

    Heat oil in a deep pan to 350°F (a wooden spoon handle will bubble steadily when oil is ready).

  5. 5

    Carefully slide potato baskets into hot oil. Fry 3–4 minutes until golden and crispy all over.

  6. 6

    Remove baskets with a slotted spoon. Drain on paper towels. Season lightly with salt while still hot.

  7. 7

    Place a crispy potato basket on a plate. Spoon spiced chickpeas into the hollow center.

  8. 8

    Dollop yogurt over the top. Serve immediately while the basket is still warm and crispy.

Tools you’ll need

  • cutting board and sharp knife
  • small paring knife
  • paper towels
  • deep saucepan or wok (at least 4 inches deep)
  • candy thermometer or instant-read thermometer
  • wooden spoon
  • slotted spoon
  • paper towel-lined plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.