Custrd is out on the App Store — Download it free →
Back to recipes

Roast Chicken with Potatoes

Crispy-skinned chicken thighs roasted over tender potatoes in one pan — seasoned simply with salt, pepper and paprika, finished with the pan juices.

Total time
45 min
Servings
4
Calories
680
Protein
46g
Roast Chicken with Potatoes
comfortingamericangluten freedairy freechickencrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat the oven to 425°F and pat the 8 chicken thighs very dry with paper towels — dry skin is what crisps.

  2. Step 2

    Halve the 1.5 lb baby potatoes and toss them on a sheet pan with 1 tbsp olive oil, 0.5 tsp salt and 0.25 tsp pepper.

  3. Step 3

    Rub the chicken all over with the remaining 2 tbsp olive oil, 1 tsp paprika, 0.5 tsp salt and 0.25 tsp pepper.

  4. Step 4

    Nestle the chicken skin-side up among the potatoes in a single layer, without stacking pieces.

  5. Step 5

    Roast 35-40 minutes, until the skin is deep golden, the potatoes are tender when pierced and the chicken juices run clear.

  6. Step 6

    Rest 5 minutes, then spoon the pan juices over the chicken and potatoes and serve.

Tools you’ll need

  • sheet pan
  • oven
  • knife
  • mixing bowl
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.