Custrd is out on the App Store — Download it free →
Back to recipes

Roast Chicken with Potato and Salad

A simple, satisfying sheet-pan dinner: juicy roasted chicken thighs and crispy potatoes, served with a fresh arugula and tomato salad dressed in lemon and olive oil.

Total time
45 min
Servings
4
Calories
520
Protein
32g
Roast Chicken with Potato and Salad
comfortingweeknightamericangluten-freechickencrispytenderweeknight dinner

Ingredients

  • 4 whole chicken thighs
  • 1.5 lb potatoes
  • 4 cups arugula
  • 1 cup cherry tomatoes
  • 3 whole green onions
  • 3 tbsp olive oil
  • 1 whole lemon
  • 1 tsp salt

Instructions

  1. 1

    Preheat oven to 425°F. Cut 1.5 lb potatoes into 1-inch chunks. Toss with 1 tbsp olive oil and 1/2 tsp salt on a baking sheet.

  2. 2

    Roast potatoes for 15 minutes, until they start to brown at edges. Meanwhile, pat 4 chicken thighs dry and season with remaining 1/2 tsp salt.

  3. 3

    Remove sheet from oven, push potatoes to one side, place chicken thighs skin-side up on the other side. Roast 25-30 minutes, until chicken is golden and juices run clear (internal temp 165°F).

  4. 4

    While chicken roasts, make salad: in a large bowl, combine 4 cups arugula, 1 cup halved cherry tomatoes, and 3 sliced green onions.

  5. 5

    Whisk together 2 tbsp olive oil and juice of 1 lemon. Pour over salad and toss to coat.

  6. 6

    Let chicken rest 5 minutes. Serve chicken and potatoes with salad on the side.

Tools you’ll need

  • baking sheet
  • large bowl
  • knife
  • cutting board
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.