CookSnap is coming soon — Join the waitlist →

Quick Turkey Pot Pie

Creamy turkey and vegetable filling topped with a golden, buttery puff pastry crust. Ready in under 45 minutes with minimal hands-on time.

Total time
40 min
Servings
4
Calories
485
Protein
38g
Quick Turkey Pot Pie
comfortcozyamericanturkeycreamytenderflakyweeknight

Ingredients

  • 3 cups cooked turkey, diced
  • 3 tbsp butter
  • 3 tbsp all-purpose flour
  • 2 cups chicken broth
  • 1.5 cups frozen mixed vegetables (peas, carrots, corn)
  • 1 sheet puff pastry sheet, thawed
  • 1 pinch salt and black pepper to taste

Instructions

  1. 1

    Preheat oven to 400°F. Melt butter in a large ovenproof skillet over medium heat, about 1 minute.

  2. 2

    Sprinkle flour over the melted butter and stir constantly for 1 minute until it turns light golden.

  3. 3

    Slowly pour in broth while whisking to prevent lumps. Stir until the sauce thickens, about 2 minutes.

  4. 4

    Add cooked turkey, frozen vegetables, salt, and pepper. Stir until combined and warm, about 2 minutes.

  5. 5

    Remove skillet from heat. Unfold puff pastry and lay it over the filling, tucking edges down into the pan.

  6. 6

    Bake uncovered until the crust is deep golden brown, 20–25 minutes. It should puff and crackle slightly.

  7. 7

    Let rest 3 minutes, then serve directly from the skillet.

Tools you’ll need

  • large ovenproof skillet (10–12 inch cast iron or oven-safe stainless steel)
  • whisk
  • wooden spoon
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.