CookSnap is in beta — Get it free on TestFlight →
Back to recipes

30-Min Pork Zongzi with Sticky Rice

Glutinous rice + savory pork parcels steamed in bamboo leaves. Skip the 2-hour soak; use a quick sear-and-steam method to get restaurant-style zongzi texture in under 30 minutes.

Total time
30 min
Servings
4
Calories
520
Protein
24g
30-Min Pork Zongzi with Sticky Rice
comfortcasualchineseporkstickytenderweeknightmeal-prep

Ingredients

  • 2 cups glutinous (sticky) rice
  • 2.5 cups water
  • ¾ lb pork shoulder, diced
  • 3 tbsp soy sauce
  • 1 tbsp sesame oil
  • 2 stalks scallions, chopped
  • 8 leaves dried bamboo leaves (soaked 10 min)
  • 1 tbsp ginger, minced

Instructions

  1. 1

    Rinse glutinous rice twice under cold water until water runs clear, then drain.

  2. 2

    Brown diced pork in a skillet over medium-high heat, stirring, until no pink remains, about 5 minutes.

  3. 3

    Add soy sauce, sesame oil, ginger, and scallions to pork. Stir for 30 seconds until fragrant, then remove from heat.

  4. 4

    Mix cooked rice with the pork filling in a bowl. Let cool 2 minutes so bamboo leaves don't wilt from steam when wrapping.

  5. 5

    Place 3 tbsp rice-pork mixture in the center of each bamboo leaf, fold into a pyramid, and secure with kitchen twine.

  6. 6

    Add 1 inch of water to a large pot, place steamer basket inside, arrange zongzi seam-side down, and steam covered for 10 minutes.

Tools you’ll need

  • 12-inch skillet
  • large pot
  • bamboo steamer basket
  • kitchen twine
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.