CookSnap is coming soon — Join the waitlist →
Back to recipes

25-Min Pork & Chestnut Zongzi

Glutinous rice parcels folded in bamboo leaves with savory pork and chestnut filling. A TikTok-friendly shortcut to the classic: pre-cooked bamboo leaves, store-bought glutinous rice, and a quick-seared pork filling.

Total time
25 min
Servings
4
Calories
420
Protein
16g
25-Min Pork & Chestnut Zongzi
comfortrusticchineseporkchewytenderweeknightmeal-prep

Ingredients

  • 2 cups, cooked glutinous rice (sticky rice)
  • ½ lb ground pork
  • ¾ cup roasted chestnuts, halved
  • 8 leaves bamboo leaves (pre-soaked dried)
  • 2 tbsp soy sauce
  • 1 tbsp sesame oil
  • 2 stalks scallions, chopped
  • 1 tbsp ginger, minced

Instructions

  1. 1

    Heat 1 tbsp neutral oil in a skillet over medium-high. Add ground pork and cook, breaking apart with a spoon, until no pink remains, ~5 minutes.

  2. 2

    Stir in minced ginger, soy sauce, and sesame oil. Fold in chestnut halves and scallions. Taste and adjust seasoning; set filling aside.

  3. 3

    Lay one bamboo leaf shiny-side down. Place 2 tbsp sticky rice in the center, then 1 tbsp pork-chestnut filling on top. Fold leaf into a tight pyramid: fold bottom corner up, then left and right corners over the top, tucking the final flap underneath.

  4. 4

    Repeat with remaining leaves, rice, and filling until all are wrapped (makes 8 zongzi).

  5. 5

    Bring a pot of salted water to boil. Submerge all zongzi and simmer for 10 minutes until they float and stay submerged.

  6. 6

    Remove zongzi with a slotted spoon and drain briefly. Serve hot with extra soy sauce or chili oil for dipping.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon
  • large pot
  • slotted spoon
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.