Custrd is out on the App Store — Download it free →
Back to recipes

Picarones con Chancaca

Crispy sweet potato and squash fritters drizzled with warm chancaca—a spiced brown sugar syrup. A beloved Peruvian dessert that's crunchy outside and tender inside.

Total time
35 min
Servings
4
Calories
428
Protein
3g
Picarones con Chancaca
indulgentcomfortperuvianvegetariancrispytenderdessertweekend

Ingredients

  • 1 large (about 12 oz) sweet potato, peeled
  • 1 small (about 10 oz) butternut squash, peeled and seeded
  • ¾ cup all-purpose flour
  • 3 cups vegetable oil for frying
  • 1 cup brown sugar
  • ½ cup water
  • ¼ tsp ground cinnamon

Instructions

  1. 1

    Cut the sweet potato lengthwise in half, then cut each half into 1/4-inch-thick coins by slicing perpendicular to the length, like cutting rounds from a log.

  2. 2

    Cut the butternut squash the same way: lengthwise into halves, then into 1/4-inch-thick coins perpendicular to the length.

  3. 3

    Place the sweet potato and squash pieces in a large bowl, sprinkle 0.75 cup flour evenly over them, and toss with your hands until all pieces are coated in a thin, even layer of flour.

  4. 4

    Pour 3 cups vegetable oil into a 5-quart heavy pot and set it over medium-high heat; wait until the oil shimmers and a single flour-dusted vegetable slice dropped in sizzles immediately and floats, about 4 minutes.

  5. 5

    Carefully place 6 to 8 flour-coated squash and sweet potato pieces into the hot oil—do not crowd the pot—and fry until the edges turn deep golden brown and the surface looks crispy, about 3 to 4 minutes, stirring gently once halfway through.

  6. 6

    Use a slotted spoon to transfer the fried pieces to a paper-towel-lined plate to drain the excess oil; repeat with remaining vegetable pieces in batches.

  7. 7

    Pour 1 cup brown sugar and 0.5 cup water into a 2-quart saucepan and set it over medium heat; stir until the sugar dissolves and the liquid turns amber-colored, about 5 to 6 minutes.

  8. 8

    Remove the pan from heat, stir in 0.25 tsp ground cinnamon until fully mixed, then let the syrup cool for 2 minutes so it thickens slightly.

  9. 9

    Arrange the warm fried fritters on a serving platter or individual plates, then drizzle the warm chancaca syrup over and around them in a thin, even stream.

Tools you’ll need

  • cutting board
  • sharp chef's knife
  • large mixing bowl
  • 5-quart heavy pot or Dutch oven
  • deep-fry or candy thermometer (optional but helpful)
  • slotted spoon
  • paper towels
  • 2-quart saucepan
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.