CookSnap is coming soon — Join the waitlist →
Back to recipes

Pesto Pasta with Blistered Tomatoes and White Beans

A pantry-friendly weeknight pasta where blistered cherry tomatoes burst into a sweet sauce and creamy white beans add unexpected substance.

Total time
20 min
Servings
4
Calories
460
Protein
17g
Pesto Pasta with Blistered Tomatoes and White Beans
pastavegetarianitalianweeknightpantry

Ingredients

  • 12 oz short pasta (fusilli, penne, or rigatoni)
  • 1 pint cherry tomatoes
  • 15 oz cannellini beans, drained and rinsed
  • ½ cup basil pesto
  • 2 garlic cloves, smashed
  • 2 tbsp olive oil
  • ¼ cup grated parmesan
  • 1 tsp kosher salt
  • 1 pinch flaky sea salt and black pepper, to finish

Instructions

  1. 1

    Bring a large pot of well-salted water to a boil and cook the pasta until al dente. Save a cup of pasta water before draining.

  2. 2

    While the pasta cooks, heat the olive oil in a wide skillet over medium-high. Add the smashed garlic and let it sizzle for about 30 seconds.

  3. 3

    Add the cherry tomatoes and a pinch of salt. Cook, shaking the pan occasionally, until most of them have burst and released their juice, about 5 minutes.

  4. 4

    Stir in the white beans and warm them through, about 2 minutes.

  5. 5

    Add the drained pasta, the pesto, and a few splashes of pasta water. Toss everything together until you have a glossy sauce that clings to the noodles. Finish with parmesan, flaky salt, and a few cracks of pepper.

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.