CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Aglio e Olio

Silky spaghetti tossed with garlic-infused olive oil, red pepper flakes, and parsley. A 15-minute Roman classic that tastes far more impressive than its ingredient list suggests.

Total time
15 min
Servings
2
Calories
512
Protein
14g
Aglio e Olio
simplefreshelegantitalianvegetarianvegansilkytender

Ingredients

  • 8 oz spaghetti
  • ½ cup olive oil
  • 6 cloves garlic cloves, thinly sliced
  • ¼ tsp red pepper flakes
  • 1 pinch salt and black pepper to taste
  • 2 tbsp fresh parsley, chopped

Instructions

  1. 1

    Boil salted water in a large pot. Add spaghetti and cook until al dente, ~9 minutes.

  2. 2

    While pasta cooks, heat olive oil in a large skillet over medium. Add garlic slices.

  3. 3

    Cook garlic, stirring constantly, until light golden and fragrant, ~2 minutes. Do not brown.

  4. 4

    Add red pepper flakes and stir for 10 seconds until the oil smells spicy.

  5. 5

    Reserve 1 cup pasta water before draining. Add drained pasta to the skillet with the oil.

  6. 6

    Toss pasta with oil over medium heat, adding pasta water 1/4 cup at a time until silky, ~1 minute total.

  7. 7

    Season with salt and pepper. Divide between bowls and top with parsley. Serve immediately.

Tools you’ll need

  • large pot
  • large skillet
  • wooden spoon
  • colander
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.