CookSnap is coming soon — Join the waitlist →
Back to recipes

Gemelli al Pesto Rosso

Silky roasted red pepper and tomato pesto coats tender gemelli pasta in this vibrant vegetarian dinner. Ready in under 30 minutes with just a few pantry staples.

Total time
25 min
Servings
4
Calories
610
Protein
18g
Gemelli al Pesto Rosso
freshsimpleitalianvegetarianvegetariancreamytenderweeknight

Ingredients

  • 1 lb gemelli pasta
  • 12 oz roasted red peppers (jarred)
  • ½ cup sun-dried tomatoes in oil
  • 3 whole garlic cloves
  • ¼ cup pine nuts
  • ½ cup parmesan cheese, grated
  • 3 tbsp olive oil
  • 1 to taste salt and black pepper

Instructions

  1. 1

    Bring a large pot of salted water to a boil. Add gemelli and cook until al dente, ~9 minutes.

  2. 2

    While pasta cooks, combine roasted red peppers, sun-dried tomatoes, garlic, pine nuts, and olive oil in a food processor.

  3. 3

    Pulse until the sauce reaches a chunky-smooth consistency, ~20 seconds.

  4. 4

    Transfer pesto to a large bowl and stir in half the parmesan. Taste and adjust salt and pepper.

  5. 5

    Drain pasta and reserve 1/2 cup cooking water. Add pasta to pesto and toss gently.

  6. 6

    Loosen with reserved pasta water if needed; sauce should coat each piece lightly.

  7. 7

    Divide between bowls and top with remaining parmesan. Serve hot.

Tools you’ll need

  • large pot
  • food processor
  • large bowl
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.