Custrd is out on the App Store — Download it free →
Back to recipes

Buttery Sage Tortelli di Zucca

Fresh cheese-and-pumpkin filled tortelli tossed in brown butter and crispy sage. If fresh tortelli aren't available, frozen works perfectly and needs no thawing.

Total time
25 min
Servings
2
Calories
520
Protein
18g
Buttery Sage Tortelli di Zucca
elegantcomfortitalianvegetariancheesetendercreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a large pot of salted water to a rolling boil over high heat.

  2. Step 2

    Add tortelli and cook until they float and have been at a rolling boil for 2–3 minutes more. Taste for tenderness — they should yield slightly when pressed.

  3. Step 3

    While tortelli cook, melt butter in a large skillet over medium heat. Add sage leaves and let them crisp and release fragrance, about 2 minutes.

  4. Step 4

    Scoop tortelli directly from the pot into the butter-sage skillet using a slotted spoon. Toss gently to coat, adding a splash of pasta water if needed.

  5. Step 5

    Divide between bowls. Shower with grated parmesan, a squeeze of lemon juice, and toasted pine nuts. Finish with a grind of black pepper.

Tools you’ll need

  • large pot (5-quart minimum)
  • large skillet (12-inch)
  • slotted spoon
  • microplane or box grater
  • large bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.