CookSnap is coming soon — Join the waitlist →
Back to recipes

Perkedel: Crispy Potato Croquettes

Golden-fried Indonesian potato croquettes filled with a fragrant onion-garlic center. Crispy outside, creamy inside—a beloved vegetarian side that doubles as a satisfying main with sambal and fresh vegetables.

Total time
45 min
Servings
4
Calories
285
Protein
5g
Perkedel: Crispy Potato Croquettes
comfortsatisfyingindonesianvegetarianvegetariancrispycreamyweeknight

Ingredients

  • 1.5 lb potatoes, russet or yellow
  • 1 tsp salt
  • 3 medium shallots, minced
  • 3 cloves garlic cloves, minced
  • 1 whole fresh red chili, minced
  • 1 whole egg, beaten
  • ¼ cup all-purpose flour
  • ¼ tsp ground white pepper
  • 1 cup vegetable oil, for frying
  • 1.5 tbsp butter

Instructions

  1. 1

    Cut potatoes into 2-inch chunks. Boil in salted water until a fork pierces easily, ~15 minutes.

  2. 2

    Drain and let cool 5 minutes. Pass through a ricer or mash until completely smooth.

  3. 3

    Heat butter in a small skillet over medium. Add shallots, garlic, and chili; cook until softened and fragrant, ~3 minutes.

  4. 4

    Fold aromatic mixture into mashed potatoes. Season with salt and white pepper. Let cool to room temperature, ~10 minutes.

  5. 5

    Pinch 2 tbsp potato mixture. Press into a ball, flatten slightly into an oval patty. Repeat with remaining mixture—makes ~12 croquettes.

  6. 6

    Pour flour onto a plate. Dip each patty in beaten egg, then coat lightly with flour; tap off excess.

  7. 7

    Heat oil in a 12-inch skillet over medium-high until shimmering, ~90 seconds. Working in batches, fry croquettes 2–3 minutes per side until deep golden brown.

  8. 8

    Transfer to a paper-towel-lined plate. Serve hot with sambal or soy sauce.

Tools you’ll need

  • large pot
  • colander
  • ricer or potato masher
  • small skillet
  • 12-inch skillet
  • instant-read thermometer (optional, for oil temp ~350°F)
  • slotted spoon or spider skimmer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.