CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Perkedel with Rice, Greens & Sambal

Golden-fried Indonesian potato fritters served with steamed rice, fresh green beans, and bright tomato sambal. A complete weeknight dinner that comes together in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
9g
Crispy Perkedel with Rice, Greens & Sambal
comfortcasualindonesianvegetarianvegetariancrispycreamyweeknight

Ingredients

  • 1 lb potatoes, peeled and halved
  • 3 stalks green onions, sliced thin
  • ¼ cup all-purpose flour
  • 1 cup rice (jasmine or white, uncooked)
  • ½ lb green beans, fresh
  • ½ cup tomato sambal (store-bought or homemade chili paste with tomato)

Instructions

  1. 1

    Boil potatoes in salted water until fork-tender, about 10 minutes. Drain and mash while still warm.

  2. 2

    Fold green onions and flour into mashed potatoes. Season with salt and pepper. Let cool 2 minutes, then shape into 8–10 oval patties.

  3. 3

    Heat 0.25 inch oil in a large skillet over medium-high until shimmering. Fry perkedel in batches until golden-brown on both sides, about 3 minutes total.

  4. 4

    While perkedel cooks, boil rice in salted water according to package directions (typically 12–15 minutes). Drain and keep warm.

  5. 5

    Steam green beans in a separate pot or microwave 4–5 minutes until tender-crisp. Season with salt and pepper.

  6. 6

    Divide rice, green beans, and perkedel among plates. Serve with tomato sambal on the side.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • medium pot or microwave-safe bowl
  • fork or potato masher
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.