CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Tostones with Garlic Mojo

Twice-fried plantain rounds crispy outside, creamy inside, finished with a bright garlic-lime mojo. Pure Cuban comfort in under 25 minutes.

Total time
25 min
Servings
2
Calories
420
Protein
2g
Crispy Tostones with Garlic Mojo
satisfyingcomfortcubanvegetariandairy-freecrispycreamyweeknight

Ingredients

  • 2 medium green plantains (not ripe)
  • 2 cups neutral cooking oil (for frying)
  • 4 cloves garlic cloves
  • 1 whole lime
  • 1 tsp salt
  • 2 tbsp fresh cilantro (chopped, optional)

Instructions

  1. 1

    Peel plantains: cut off ends, score skin lengthwise, peel back. Slice into 1-inch rounds.

  2. 2

    Heat oil in a heavy skillet over medium-high until a plantain round sizzles instantly when dropped in.

  3. 3

    Working in batches, fry plantain rounds 2–3 minutes per side until golden. Transfer to a paper-towel-lined plate.

  4. 4

    Let cool for 1 minute. Flatten each round between two paper towels using the bottom of a glass or skillet.

  5. 5

    Fry flattened rounds again, 1–2 minutes per side, until deep golden and crispy. Drain on fresh paper towels.

  6. 6

    Pound garlic with salt until paste forms. Stir in juice from lime. Drizzle mojo over hot tostones, garnish with cilantro if desired.

Tools you’ll need

  • heavy-bottomed skillet or deep frying pan (12-inch minimum)
  • paper towels
  • slotted spoon or spider strainer
  • mortar and pestle (or small bowl and fork)
  • kitchen knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.