Perfect Cheese Omelet
A simple two-fold omelet with melted cheese, ready in under 10 minutes. Fluffy eggs, a handful of cheese, and butter are all you need.
- Total time
- 8 min
- Servings
- 1
- Calories
- 285
- Protein
- 17g
quicksimpleamericanvegetarianeggsfluffymeltyweeknight
Ingredients
- 2 large eggs
- 1 tbsp butter
- ⅓ cup cheese, shredded
Instructions
- 1
Crack eggs into a bowl, add a pinch of salt and pepper, and whisk until no white streaks remain.
- 2
Heat butter in an 8-inch nonstick skillet over medium until it foams and smells nutty.
- 3
Pour in eggs and let sit 30 seconds, then drag edges to center with a spatula, tilting skillet so raw egg fills gaps.
- 4
When top is nearly set but still slightly wet, scatter cheese over one half.
- 5
Fold omelet in half and slide onto a plate.
Tools you’ll need
- 8-inch nonstick skillet
- bowl
- whisk
- spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
